This is a working overview of calibration curve, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-03-14. Anything still debated is marked as such rather than presented as settled.
Developing an HPLC method begins with defining the purpose, such as quantifying a main component, measuring impurities, or confirming identity. Analysts select separation mode, column, mobile phase, detection, and sample preparation based on analyte properties and matrix. Experiments vary solvent strength, pH, buffer type, and temperature to achieve resolution between critical peaks. The goal is a robust method that produces reliable results across instruments and operators. Method development often involves trial runs and statistical optimization.
Validation demonstrates that a method is suitable for its intended use. Typical performance characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulators and standards organizations provide frameworks, but specific requirements depend on the application and jurisdiction. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, retention time repeatability, and sensitivity. A validated method is not permanently fixed; changes may require partial or full revalidation.
Routine HPLC testing depends on controlled reagents, calibrated instruments, and documented procedures. Columns degrade over time, so retention times and peak shapes are monitored for drift. Mobile phases are filtered and degassed to prevent pump damage and detector noise. Reference standards must be traceable and stored under suitable conditions. Data handling systems record injections, calculations, and audit trails. Quality control samples interspersed with unknowns help detect errors during a run.
Instrumentation includes a solvent delivery system, an autosampler, a column oven, and one or more detectors. Reversed-phase columns with chemically modified silica are widely used, but normal-phase, ion-exchange, size-exclusion, and affinity modes exist for specific separations. Detectors may rely on ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry. Column temperature, mobile phase composition, and flow rate are adjusted to improve resolution. System pressure is monitored because rising pressure can indicate column blockage or deteriorating packing.
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Closeness of measured value to accepted reference value |
| Validation parameter | Precision | Agreement among repeated measurements under specified conditions |
| System suitability check | Resolution ≥ 1.5 | Baseline separation between critical peak pair |
| System suitability check | Tailing factor ≤ 2.0 | Common target for peak symmetry |
| Documentation | Validation report | Summarizes experiments, acceptance criteria, and conclusions |
Quality control for HPLC testing combines scheduled checks, documented procedures, and review of results. Before sample analysis, system suitability testing confirms that the instrument, column, and method meet predefined criteria. Common criteria include resolution between critical peaks, retention time precision, peak tailing, and theoretical plate count. Failure triggers investigation before results are reported. Records link raw data, calculations, instrument logs, and analyst identity to each batch, supporting audits and repeat analysis.
Method validation evaluates accuracy, precision, specificity, linearity, range, detection limit, quantitation limit, and robustness. Regulatory guidance for pharmaceuticals, foods, and environmental testing defines expected documentation and acceptance criteria. Verification confirms that a validated method works in a specific laboratory with its own instruments and reagents. Calibration curves use reference standards with known purity and traceability, while measurement uncertainty is estimated from validation data, control charts, and collaborative studies. The scope of validation depends on the method's intended use.
Routine quality control monitors retention time shifts, baseline noise, system pressure, and peak shape. Trends can reveal column aging, mobile phase preparation errors, detector drift, or sample degradation. Corrective actions may include replacing the column, preparing fresh mobile phase, or recalibrating the detector. Stability testing often uses HPLC to measure parent compound loss and degradation product formation. Open questions remain about how accelerated stability results extrapolate to long-term storage under varied conditions.
Method validation demonstrates that an analytical procedure is suitable for its intended purpose. Typical validation characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulatory guidance from bodies such as the International Council for Harmonisation and the United States Pharmacopeia outlines expectations, though specific criteria depend on the product and method. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, column efficiency, and injection repeatability. Failure of these checks can invalidate a batch of measurements.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
Quality control laboratories use HPLC to check identity, purity, concentration, and stability of raw materials and finished products. A validated method specifies the column, mobile phase, flow rate, detection wavelength, injection volume, and run time. Samples are prepared and compared against reference standards of known concentration. The resulting chromatogram provides quantitative data, such as assay values and impurity levels. This approach is common in pharmaceutical, food, environmental, and industrial testing where consistent measurements are required.
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample. A pump moves a liquid mobile phase through a column packed with a solid stationary phase. Compounds interact differently with both phases and travel at different rates, leaving the column at distinct retention times. A detector records these arrivals as peaks on a chromatogram. The resulting pattern supports identification and quantification of substances in mixtures. Modern instruments use high pressure to force solvent through small particles, which improves speed and resolution compared with older low-pressure liquid chromatography methods.
Separation in HPLC depends on the chemistry of the stationary phase, the composition of the mobile phase, and the physical properties of the column. Reverse-phase separations use a nonpolar stationary phase and a polar mobile phase, and they are common for many organic compounds. Ion-exchange, size-exclusion, and normal-phase modes serve other classes of analytes. Gradient elution changes solvent strength over time, while isocratic elution holds it constant. Flow rate, temperature, particle size, and column length all influence peak shape and resolution. Detection may use ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry, depending on the analyte and the required sensitivity.
Parker was born in March 1938, and was the only daughter of Frederick and Hilda Witcomb (née Linscott). She was married to Joseph Parker, a Post Office engineer, and lived in the Kings Norton area of Birmingham. After several years as a police photographer, she joined the University of Birmingham Medical School, where she was employed as a medical photographer in the Anatomy Department. She often worked in a darkroom above the laboratory where research on smallpox viruses was being conducted.
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Affinity chromatography can be used in a number of applications, including nucleic acid purification, protein purification from cell free extracts, and purification from blood. By using affinity chromatography, one can separate proteins that bind to a certain fragment from proteins that do not bind that specific fragment. Because this technique of purification relies on the biological properties of the protein needed, it is a useful technique and proteins can be purified many folds in one step.
Sources: en.wikipedia.org
an intermediate or building block in the synthesis of non-ionic and other surfactants and related functional additives; a component of lubricant and plastic additive systems, including thermoplastic polyurethanes, where long-chain alcohols are used to modify flexibility and permeability; a minor constituent of policosanol-type mixtures employed in cosmetics and personal-care products as part of the lipid phase of creams and emulsions. Because of its chain length and structural similarity to other fatty alcohols, 1-heneicosanol is also used as a reference compound and analytical standard in studies of plant waxes, policosanol mixtures and related lipid fractions. Available safety data sheets describe 1-heneicosanol as a low-volatility solid that is not classified as hazardous under European CLP regulations, but which may cause mild irritation to the skin, eyes and respiratory tract on contact or inhalation of dust. Standard laboratory precautions such as avoiding dust formation, using local exhaust ventilation and wearing eye and skin protection are recommended.
Patients with Type II diabetes will have elevated glucagon levels during a fast and after eating. These elevated glucagon levels over stimulate the liver to undergo gluconeogenesis, leading to elevated blood glucose levels. Consistently high blood glucose levels can lead to organ damage, neuropathy, blindness, cardiovascular issues and bone and joint problems. It is not entirely clear why glucagon levels are so high in patients with Type II diabetes. One theory is that the alpha cells have become resistant to the inhibitory effects of glucose and insulin and do not respond properly to them. Another theory is that nutrient stimulation of the gastrointestinal tract, thus the secretion of gastric inhibitory polypeptide and Glucagon-like peptide-1, is a very important factor in the elevated secretion of glucagon.
AlphaFold's predicted structures are widely used in biological research, though the precise scale of that use is difficult to measure. More than 40% of protein-structure papers published in 2023 in Cell, Nature, and Science cited AlphaFold 2. A 2024 bibliometric analysis of the Web of Science database identified 1,680 peer-reviewed papers referencing AlphaFold published between January 2019 and May 2024. Measures of this kind rely on authors citing the AlphaFold papers when they use the tool, a convention encouraged but not enforced by the maintainers of the AlphaFold Protein Structure Database. Attempts to validate these counts against the full text of papers suggest that citations to foundational AlphaFold papers can both overstate and understate how widely the tool is used. In an analysis of about 8,900 papers in the PubMed Central Open Access corpus that mentioned AlphaFold, roughly 30% cited none of three foundational AlphaFold papers, while only about half of the papers citing at least one of those three mentioned AlphaFold anywhere in their text. A smaller manual check of 100 papers from a curated protein-literature database found a similar shortfall, with fewer than half of those mentioning AlphaFold including a formal citation.
Sources: en.wikipedia.org
Alpha-synuclein has been shown to interact with Dopamine transporter, Parkin (ligase), Phospholipase D1, SNCAIP, Tau protein. Beta amyloid Synuclein Contursi Terme - the village in Italy where a mutation in the α-synuclein gene led to a family history of Parkinson's disease Anti-α-synuclein drug Media related to Alpha-synuclein at Wikimedia Commons alpha-Synuclein at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Human SNCA genome location and SNCA gene details page in the UCSC Genome Browser.
Currently, there are 10 ACE inhibitors approved for use in the United States by the FDA: captopril (1981), enalapril (1985), lisinopril (1987), benazepril (1991), fosinopril (1991), quinapril (1991), ramipril (1991), perindopril (1993), moexipril (1995) and trandolapril (1996). ACE inhibitors are easily identifiable by their common suffix, '-pril'. ACE inhibitors can be divided into three groups based on their molecular structure of the enzyme binding sites (sulfhydryl, phosphinyl, carboxyl) to the active center of ACE: Alacepril Captopril (trade name Capoten), the first ACE inhibitor. Zofenopril These agents appear to show antioxidative properties but may be involved in adverse events such as skin eruptions. This is the largest group, including:
The ABC domain consists of two domains, the catalytic core domain similar to RecA-like motor ATPases and a smaller, structurally diverse α-helical subdomain that is unique to ABC transporters. The larger domain typically consists of two β-sheets and six α helices, where the catalytic Walker A motif (GXXGXGKS/T where X is any amino acid) or P-loop and Walker B motif (ΦΦΦΦD, of which Φ is a hydrophobic residue) is situated. The helical domain consists of three or four helices and the ABC signature motif, also known as LSGGQ motif, linker peptide or C motif. The ABC domain also has a glutamine residue residing in a flexible loop called Q loop, lid or γ-phosphate switch, that connects the TMD and ABC. The Q loop is presumed to be involved in the interaction of the NBD and TMD, particularly in the coupling of nucleotide hydrolysis to the conformational changes of the TMD during substrate translocation. The H motif or switch region contains a highly conserved histidine residue that is also important in the interaction of the ABC domain with ATP. The name ATP-binding cassette is derived from the diagnostic arrangement of the folds or motifs of this class of proteins upon formation of the ATP sandwich and ATP hydrolysis.
The main method of treatment for potential death from signaling-related diseases involves either increasing or decreasing the susceptibility of apoptosis in diseased cells, depending on whether the disease is caused by either the inhibition of or excess apoptosis. For instance, treatments aim to restore apoptosis to treat diseases with deficient cell death and to increase the apoptotic threshold to treat diseases involved with excessive cell death. To stimulate apoptosis, one can increase the number of death receptor ligands (such as TNF or TRAIL), antagonize the anti-apoptotic Bcl-2 pathway, or introduce Smac mimetics to inhibit the inhibitor (IAPs). The addition of agents such as Herceptin, Iressa, or Gleevec works to stop cells from cycling and causes apoptosis activation by blocking growth and survival signaling further upstream. Finally, adding p53-MDM2 complexes displaces p53 and activates the p53 pathway, leading to cell cycle arrest and apoptosis. Many different methods can be used either to stimulate or to inhibit apoptosis in various places along the death signaling pathway. Apoptosis is a multi-step, multi-pathway cell-death programme that is inherent in every cell of the body. In cancer, the apoptosis cell-division ratio is altered. Cancer treatment by chemotherapy and irradiation kills target cells primarily by inducing apoptosis.
Sources: en.wikipedia.org
It is a set of checks performed before or during an HPLC run to confirm the system works as expected. Parameters may include resolution, tailing factor, theoretical plates, and retention time precision. Failure can trigger maintenance, method adjustment, or repeat analysis.
Validation follows a planned protocol that tests accuracy, precision, specificity, linearity, range, detection limits, quantitation limits, and robustness. Results are compared against predefined acceptance criteria. The validation report supports regulatory filing or routine use.
Revalidation may be needed after changes to column chemistry, mobile phase, detection, sample preparation, or instrument type. It can also follow a pattern of out-of-specification results. The scope depends on whether the change affects method performance.
HPLC separates and detects individual compounds in a liquid sample, producing peaks at characteristic retention times. Peak area or height can be used to estimate concentration when calibrated with known standards. It does not identify unknown compounds with certainty unless additional detectors or reference materials are used.