reconstitution comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Updated 2025-11-30. Numbers and descriptions here follow the published literature rather than marketing material.
Reversed-phase high-performance liquid chromatography is widely used to assess purity and to separate the parent peptide from related substances. Mass spectrometry confirms identity and can resolve modifications that differ by a few daltons. Size-exclusion chromatography detects dimers and higher aggregates, which are relevant to both stability and immunogenicity questions. Peptide mapping with enzymatic digestion locates specific modifications along the sequence. Circular dichroism provides a secondary-structure profile, although it gives limited information about local conformational changes.
Quality control for peptide material focuses on identity, purity, content and the profile of impurities. Common degradants include deamidated and oxidised forms, plus aggregates formed during storage or handling. Forced degradation studies under heat, light, acid and peroxide help define which conditions accelerate change and which analytical methods detect it. Limits for individual impurities are set by pharmacopoeial monographs or manufacturer specifications. How much a given impurity affects biological activity is often uncertain, and conclusions may depend on the assay used.
Solid peptide material is generally kept at reduced temperature to limit degradation. Short-term storage at 2 to 8 degrees Celsius is common, while longer archival storage at minus 20 degrees Celsius or below is typical for lyophilised powder. Vials should remain sealed and protected from light, because ultraviolet exposure can oxidise susceptible residues. Repeated freeze-thaw cycles are avoided, as they promote aggregation and loss of soluble material. Solutions are less stable than solids and are usually prepared close to the time of use.
Two structural features account for the prolonged half-life of semaglutide. A modified amino acid at position 8 resists cleavage by dipeptidyl peptidase-4, the enzyme that rapidly degrades native GLP-1. A fatty diacid side chain binds serum albumin, which limits renal clearance and protects the peptide from enzymatic breakdown. These modifications yield a plasma half-life of approximately one week in humans, allowing once-weekly administration. The relationship between plasma concentration and clinical effect varies between individuals, and sources of that variability are still being characterized.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1 (GLP-1), a hormone released from intestinal L-cells after food intake. The compound belongs to the incretin mimetic class and acts at GLP-1 receptors distributed across pancreatic, gastrointestinal, cardiovascular, and central nervous system tissues. Compared with native GLP-1, the molecule carries structural changes that extend its activity from minutes to roughly one week. It is studied for glycemic control in type 2 diabetes and for weight management, and its effects on cardiovascular and other outcomes remain active research areas.
Receptor binding triggers G protein signaling that raises intracellular cyclic AMP in pancreatic beta cells. Insulin release follows in a glucose-dependent manner, so secretion increases when blood glucose is elevated and diminishes when it is not. The same signaling suppresses glucagon release from alpha cells and slows gastric emptying, which blunts the post-meal glucose rise. In the brain, receptor activation in regions such as the arcuate nucleus is associated with reduced appetite and lower energy intake. How much each of these effects contributes to overall weight change is not fully settled.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white lyophilised powder | Visual inspection under suitable light |
| Aqueous solubility | Soluble, pH dependent | Dissolves readily in neutral buffer |
| Storage temperature | 2-8 °C short term; -20 °C or below long term | Protect from light and moisture |
| Primary purity method | Reversed-phase HPLC | UV detection near 214 nm |
| Identity confirmation | LC-MS with peptide mapping | Mass accuracy within a few ppm |
Storage guidance for the finished injectable product distinguishes the unused state from the in-use state. Before first use, pens are kept refrigerated between 2 and 8 degrees Celsius, protected from light, and never frozen, since freezing can disrupt the peptide or the device. After first use, label instructions in several markets permit storage at room temperature up to about 30 degrees Celsius for a limited number of days. Solid research-grade material is normally held at or below minus 20 degrees Celsius, often with desiccant, and allowed to equilibrate before opening.
Quantification and purity assessment rely on separation methods coupled to optical or mass detection. Reversed-phase high-performance liquid chromatography resolves the intact peptide from related impurities and is the standard assay technique. Size-exclusion chromatography measures aggregates, while ion-exchange chromatography separates charge variants produced by deamidation. Mass spectrometry confirms identity and detects mass shifts of a few daltons. In biological matrices, liquid chromatography with tandem mass spectrometry is often used because immunoassays can cross-react with endogenous GLP-1 or with circulating fragments.
Large randomised trials in adults with type 2 diabetes and in adults with obesity have reported reductions in body weight and improvements in several cardiovascular risk markers. One outcome trial found a lower incidence of major adverse cardiovascular events in participants with diabetes and established cardiovascular disease. Gastrointestinal effects such as nausea and vomiting are the most frequently reported adverse events and often diminish over time. Changes in lean body mass during weight loss are an area of ongoing investigation. Effects in adolescents and in pregnancy are less well characterised, and current labelling advises against use during pregnancy.
Semaglutide is a synthetic peptide analogue of glucagon-like peptide-1, a gut hormone released after nutrient intake. The molecule contains 31 amino acid residues and differs from the native sequence at several positions. A non-natural residue at position eight resists the enzyme that normally truncates the hormone, while a lysine-linked fatty diacid side chain promotes binding to serum albumin. These two modifications extend the circulating half-life from minutes to roughly one week. The peptide is produced by solid-phase synthesis followed by selective acylation, and its identity and purity are confirmed by spectrometric and chromatographic techniques.
Reconstituted solutions are less stable than the dry powder, and stability depends on concentration, pH, buffer composition, and container material. Low-protein-binding tubes reduce loss of peptide to plastic surfaces. Some researchers add a carrier protein to limit adsorption at low concentrations. The exact shelf life of a given solution is best determined empirically through a stability study rather than assumed from general guidance, because published data cover only a limited set of conditions.
Storage conditions for semaglutide depend heavily on the presentation. Lyophilized research powder is generally kept at two to eight degrees Celsius in a sealed container, protected from light and moisture. Manufacturer labeling for finished injectable products specifies refrigeration before first use, with defined in-use periods at room temperature afterward. The oral tablet form is stored at controlled room temperature and is more tolerant of short excursions. Temperature excursions should be documented rather than inferred.
== I == ichthyology – immune cell – immune system – immunology – inbreeding – inducibility – infectious disease carrier – infertility – inner matrix – insect – insectivores – insulin – intermediate filament – intermembrane space – interphase – intestine – intron – invasive species – ion channel – isoenzyme – isotonic (exercise physiology)
Pyrolysis–gas chromatography–mass spectrometry is a method of chemical analysis in which the sample is heated to decomposition to produce smaller molecules that are separated by gas chromatography and detected using mass spectrometry.
==== Legal Considerations ==== In the United States brands applied by any method often must be registered with a state or county office. In some jurisdictions, it is illegal to brand an animal without first registering the design with a state office. The following table summarizes the legal recognition and requirements for equine freeze brands in the United States:
Nickel video from the Periodic Videos series (University of Nottingham) Nickel entry (last reviewed October 30, 2019) in the NIOSH Pocket Guide to Chemical Hazards published by the CDC's National Institute for Occupational Safety and Health Toxicological Profile for Nickel (draft for public comment) (PDF) (August 2023) – 422-page report from the United States Department of Health and Human Services, Public Health Service, Agency for Toxic Substances and Disease Registry The metal that brought you cheap flights, BBC News (2015) usgs.gov: Nickel
== Early life and education == Meinrad Busslinger was born on 30 July 1952 in Gebenstorf, Switzerland. He grew up in the Swiss town of Zug, where he obtained his grammar school education. From 1972 to 1976, he studied natural sciences at the Swiss Federal Institute of Technology (ETH Zurich), where he majored in biochemistry. During his PhD studies (1976–1981), Busslinger discovered important regulatory elements involved in the transcriptional control of gene expression by investigating the regulation of sea urchin histone genes. He performed his PhD work under the supervision of Max L. Birnstiel at the University of Zurich, from where he received a PhD degree in molecular biology in 1981.
Sources: en.wikipedia.org
==== Analysis and appreciation ==== Birzer, Bradley J. Cultural Repercussions: An In-Depth Examination of the Words, Ideas and Professional Life of Neil Peart, Man of Letters. Wordfire Press, 2015. ISBN 1614753547. Bowman, Durrell and Berti, Jim. Rush and Philosophy: The Heart and Mind United. Open Court Press, 2011. ISBN 978-0812697162. Bowman, Durrell. Experiencing Rush: A Listener's Companion. Rowman & Littlefield Publishers, 2014. ISBN 1442231300. Freedman, Robert. Rush: Life, Liberty, and the Pursuit of Excellence. Algora Pub, 2014. ISBN 1628940840. McDonald, Chris. Rush, Rock Music, and the Middle Class: Dreaming in Middletown. Indiana University Press, 2009. ISBN 0-253-22149-8. Mobley, Max. Rush FAQ: All That's Left to Know About Rock's Greatest Power Trio. Backbeat Books, 2014. ISBN 1617134511. Popoff, Martin. Rush: Album by Album. Voyageur Press, 2017. ISBN 978-0760352205. Price, Carol S. and Robert M. Price. Mystic Rhythms: The Philosophical Vision of Rush. Wildside Press, 1999. ISBN 1-58715-102-2. Roberto, Leonard. A Simple Kind Mirror: The Lyrical Vision of Rush. Iuniverse Star, 2000. ISBN 0595213626. Telleria, Robert. Rush Tribute: Merely Players. Quarry Press, 2002. ISBN 1-55082-271-3.
Pursuant to the National Defense Act of 1920, the 82nd Division was reconstituted in the Organized Reserve on 24 June 1921, allotted to the Fourth Corps Area, assigned to the XIV Corps, and further allotted to Florida, Georgia, and South Carolina as its home area. The division headquarters was organized on 23 September 1921 at 1202-1/2 Main Street in Columbia, South Carolina. In 1923, it relocated to the Post Office Building, where it remained until activated for World War II. The 82nd Division's designated mobilization station was Camp McClellan, Alabama, also where much of the unit's annual training activities occurred in the interwar years. The headquarters usually trained at Camp McClellan, but also occasionally trained with the staff of the 8th Infantry Brigade, 4th Division. The 82nd Division's infantry regiments held their annual training primarily with the units of the 8th Infantry Brigade, while other units, such as the special troops, artillery, engineers, aviation, medical, and quartermaster units, usually trained alongside the active elements of the 4th Division at various posts in the Fourth Corps Area. For example, the division artillery trained with the units of the 13th Field Artillery Brigade at Fort Bragg, North Carolina; the 307th Engineer Regiment alongside Company A, 4th Engineer Regiment at Fort Benning, Georgia; the 307th Medical Regiment trained at the medical officers training camp at Fort Oglethorpe, Georgia; and the 307th Observation Squadron with Air Corps units at Maxwell Field, Alabama.
==== Trichochromes ==== Trichochromes (formerly called trichosiderins) are pigments produced from the same metabolic pathway as the eumelanins and pheomelanins, but unlike those molecules they have low molecular weight. They occur in some red human hair.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
3,4-Methylenedioxymethamphetamine (MDMA), commonly known as ecstasy in tablet form, and molly in crystal form, is an entactogen with stimulant and minor psychedelic properties. MDMA was first synthesized in 1912 by Merck chemist Anton Köllisch. It was used to enhance psychotherapy beginning in the 1970s and became popular as a street drug in the 1980s. MDMA is commonly used by attendees of dance parties, raves, and electronic dance music festivals. Tablets sold as ecstasy may be mixed with other substances such as ephedrine, amphetamine, and methamphetamine. The lethal risk from one dose of MDMA is estimated to be from 1 death in 20,000 instances to 1 death in 50,000 instances. The purported pharmacological effects that may be prosocial include altered sensations, increased energy, empathy, and pleasure. When taken by mouth, effects begin in 30 to 45 minutes and last three to six hours. Short-term adverse effects include bruxism, blurred vision, sweating, and tachycardia, and extended use can also lead to addiction, amnesia, memory disorders, paranoia, and insomnia. Deaths have been reported due to increased body temperature and dehydration. MDMA acts primarily by increasing the release of the neurotransmitters serotonin, dopamine, and norepinephrine in parts of the brain. It belongs to the substituted amphetamine classes of drugs. MDMA is structurally similar to mescaline (a psychedelic), methamphetamine (a stimulant), as well as endogenous monoamine neurotransmitters such as serotonin, norepinephrine, and dopamine.
=== Melting point === As a pure material, bronopol has a melting point of about 130 °C. However, due to its polymorphic characteristics, bronopol undergoes a lattice rearrangement at 100 to 105 °C and this can often be wrongly interpreted as the melting point. At temperatures above 140 °C, bronopol decomposes exothermically releasing hydrogen bromide and oxides of nitrogen.
==== Government budgetary limitations ==== Instituting MS/MS screening often requires a sizable up front expenditure. When states choose to run their own programs the initial costs for equipment, training and new staff can be significant. Moreover, MS/MS gives only the screening result and not the confirmatory result. The same has to be further done by higher technologies or procedure like GC/MS, Enzyme Assays or DNA Tests. This in effect adds more cost burden and makes physicians lose precious time. To avoid at least a portion of the up front costs, some states such as Mississippi have chosen to contract with private labs for expanded screening. Others have chosen to form Regional Partnerships sharing both costs and resources. But for many states, screening has become an integrated part of the department of health which can not or will not be easily replaced. Thus the initial expenditures can be difficult for states with tight budgets to justify. Screening fees have also increased in recent years as health care costs rise and as more states add MS/MS screening to their programs. (See Report of Summation of Fees Charged for Newborn Screening, 2001–2005) Dollars spent for these programs may reduce resources available to other potentially lifesaving programs. It was recommended in 2006 that one disorder, Short Chain Acyl-coenzyme A Dehydrogenase Deficiency, or SCAD, be eliminated from screening programs, due to a "spurious association between SCAD and symptoms.
A G cell or gastrin cell is a type of cell in the stomach and duodenum that secretes gastrin. It works in conjunction with gastric chief cells and parietal cells. G cells are found deep within the pyloric glands of the stomach antrum, and occasionally in the pancreas and duodenum. The vagus nerve innervates the G cells. Gastrin-releasing peptide is released by the post-ganglionic fibers of the vagus nerve onto G cells during parasympathetic stimulation. The peptide hormone bombesin also stimulates gastrin from G cells. Gastrin-releasing peptide, as well as the presence of amino acids in the stomach, stimulates the release of gastrin from the G cells. Gastrin stimulates enterochromaffin-like cells to secrete histamine. Gastrin also targets parietal cells by increasing the amount of histamine and the direct stimulation by gastrin, causing the parietal cells to increase HCl secretion in the stomach. G-cells frequently express PD-L1 during homeostasis which protects them from Helicobacter pylori-induced immune destruction.
16 May – Greggs reaches a deal with Westminster City Council to allow it to sell food and hot drinks at its Leicester Square outlet until 2.00am on some nights. The council had objected to a previous plan for 24-hour opening amid concerns it would attract antisocial behaviour, with the agreement reached as a court case was about to commence. 17 May – The £2 cap on bus fares in England is extended until the end of October; a £2.50 cap will then be in place until December 2024. 18 May – Two teenage cousins are sentenced to life imprisonment for the murder of Khayri Mclean, who was stabbed in Huddersfield, West Yorkshire in 2022 as he walked home from school. 22 May – After the latest round of talks with the government end without resolution, the British Medical Association announces that junior doctors will stage another 72-hour strike, scheduled to begin on 14 June. 23 May – Samantha Lee, a former Metropolitan Police constable who failed to properly investigate two counts of indecent exposure committed by Wayne Couzens, is found guilty of gross misconduct following a hearing. David Boyd is sentenced to life imprisonment with a minimum term of 29 years for the 1992 murder of Nikki Allan. 25 May – The UK Health Security Agency urges people at risk of contracting the Mpox virus to get vaccinated after 10 new cases were discovered in London between 30 April and 25 May.
Sources: en.wikipedia.org
Lower temperatures slow hydrolysis, oxidation and aggregation reactions that degrade the molecule over time. Lyophilised powder is more tolerant than solution, but both benefit from controlled conditions.
Mass spectrometry and peptide mapping are commonly used, often alongside chromatographic retention time comparison. No single technique covers both sequence and higher-order structure.
Aggregation is monitored because it can alter activity and may influence immune responses. Size-exclusion chromatography and related techniques are used to quantify it.
Native GLP-1 is degraded within minutes by dipeptidyl peptidase-4 and cleared quickly. Semaglutide carries a position 8 substitution that blocks that cleavage and a fatty diacid chain that binds albumin. Together these changes extend its circulating half-life to about one week.